PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010916003.1
Common NameNAM1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 353aa    MW: 38922.9 Da    PI: 7.8366
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010916003.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.25.4e-56171451129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL kkv +++++  ++i+e+d++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+
  XP_010916003.1  17 LPPGFRFHPTDEELITYYLLKKVLDSSFTG-RAIAEIDLNKCEPWELPEKAKMGEKEWYFFSLRDRKYPTGLRTNRATDAGYWKATGKDREIYSS 110
                     79*************************999.89***************99999****************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +g+lvg+kktLvfykgrapkgek++Wvmheyrle
  XP_010916003.1 111 rTGSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 145
                     78889****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-6410169IPR003441NAC domain
PROSITE profilePS5100560.88117169IPR003441NAC domain
PfamPF023651.0E-2818144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MSMESYGHHF DSSEAQLPPG FRFHPTDEEL ITYYLLKKVL DSSFTGRAIA EIDLNKCEPW  60
ELPEKAKMGE KEWYFFSLRD RKYPTGLRTN RATDAGYWKA TGKDREIYSS RTGSLVGMKK  120
TLVFYKGRAP KGEKSNWVMH EYRLEGKFAY HFLSRSSKDE WVVSRVFQKS GCGKKARVGL  180
AGSHYSESTS VSPSAASLPP LFDSSPYGAA AAAGDRDSCS YESTEREPVP CFSTVVATTA  240
SSGLGHHHHH HLAPPPVPNM FGRSTAGGVV GSVFPCLRSL QENLQLPFFL STPAPPVGVA  300
ASAAMVCDGG VHHRVEEIGV NCWPSDLERK AEVAGRAHQM TVGSTELDCL WTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-541317513171NO APICAL MERISTEM PROTEIN
1ut4_B6e-541317513171NO APICAL MERISTEM PROTEIN
1ut7_A6e-541317513171NO APICAL MERISTEM PROTEIN
1ut7_B6e-541317513171NO APICAL MERISTEM PROTEIN
3swm_A7e-541317516174NAC domain-containing protein 19
3swm_B7e-541317516174NAC domain-containing protein 19
3swm_C7e-541317516174NAC domain-containing protein 19
3swm_D7e-541317516174NAC domain-containing protein 19
3swp_A7e-541317516174NAC domain-containing protein 19
3swp_B7e-541317516174NAC domain-containing protein 19
3swp_C7e-541317516174NAC domain-containing protein 19
3swp_D7e-541317516174NAC domain-containing protein 19
4dul_A6e-541317513171NAC domain-containing protein 19
4dul_B6e-541317513171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010916003.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2
SwissprotO040171e-109NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLF2WAC50.0F2WAC5_ELAGV; No apical meristem-related protein
STRINGGSMUA_Achr10P22350_0011e-156(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99403543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-100NAC family protein
Publications ? help Back to Top
  1. Adam H, et al.
    Divergent expression patterns of miR164 and CUP-SHAPED COTYLEDON genes in palms and other monocots: implication for the evolution of meristem function in angiosperms.
    Mol. Biol. Evol., 2011. 28(4): p. 1439-54
    [PMID:21135149]